PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676764380
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family YABBY
Protein Properties Length: 164aa    MW: 17856.4 Da    PI: 10.341
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676764380genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY140.81.5e-4371475163
      YABBY   5 ssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvsseklsen 104
                 ++e++ yv+C+ Cntilav +P++ ++ +vtv+CGhC +l  ++ +      + + h        +   l  + +++   + k+ s+s+s ss   +++
  676764380   7 PQAEHLYYVRCSICNTILAVGIPMKRMLDTVTVKCGHCGNLSFLTTSP-----PLQGH--------VS--LTLQMQSFGGSEYKKGSSSSSSSS---TSS 88 
                5789***********************************975533322.....22232........32..333445566666666666666666...457 PP

      YABBY 105 edeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahf 163
                e+  +pr+p v++PPek+qr Psaynrf+++eiqrik +nP+i hreafsaaaknWa +
  676764380  89 EQPPSPRPPFVVKPPEKKQRLPSAYNRFMRDEIQRIKGANPEIPHREAFSAAAKNWAKY 147
                78899**999***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046907.4E-509147IPR006780YABBY protein
SuperFamilySSF470951.15E-891146IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.104.7E-5101146IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010254Biological Processnectary development
GO:0010582Biological Processfloral meristem determinacy
GO:0048479Biological Processstyle development
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MASRASPQAE HLYYVRCSIC NTILAVGIPM KRMLDTVTVK CGHCGNLSFL TTSPPLQGHV  60
SLTLQMQSFG GSEYKKGSSS SSSSSTSSEQ PPSPRPPFVV KPPEKKQRLP SAYNRFMRDE  120
IQRIKGANPE IPHREAFSAA AKNWAKYVPN SPTSITSGAS NINK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00220DAPTransfer from AT1G69180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ1190550.0DQ119055.1 Brassica juncea transcription factor CRC mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009105464.11e-108PREDICTED: protein CRABS CLAW
RefseqXP_013652319.11e-108PREDICTED: protein CRABS CLAW
SwissprotQ8L9252e-98CRC_ARATH; Protein CRABS CLAW
TrEMBLM4CJI01e-108M4CJI0_BRARP; Uncharacterized protein
STRINGBra004364.1-P1e-107(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM97252835
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69180.11e-80YABBY family protein